DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG30288

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:272 Identity:94/272 - (34%)
Similarity:139/272 - (51%) Gaps:20/272 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VIAICL-IRQQRIVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTHCGGSIL 72
            ||..|| |...|....:.|...||.|..:....|:..|::|.:.|.|:||.|..:....||||::
  Fly     9 VIVACLFIGIIRTESGRLLENDCGTTSSNGYRARIDGGRDAGMESNPWMVRVMISGKAVCGGSLI 73

  Fly    73 NSRYILTAAHCVFP-NLRLRLGEHNIRTDP--DCQGSNCSPRSEEYGIMKAITHRFYNAANHVND 134
            .:|::|||.||:.| .:.:||||::.| .|  ||....|:||:....:.:.|.|     :|...|
  Fly    74 TARFVLTAEHCISPMYMNVRLGEYDTR-HPIFDCDDFVCTPRAYNVDVDRKIVH-----SNPGYD 132

  Fly   135 IALLKLNRSINFNVHIQPICILL------NPASAPSVATYQTFGWGETKKNGFPHLLQTAELRAY 193
            |.||::.||:.|:.:::|||::|      ||.   |:..:...|||..........||||.|:..
  Fly   133 IGLLRMQRSVIFSNYVRPICLILGKTLGGNPL---SILRFNFTGWGTNSDGEEQDRLQTATLQQL 194

  Fly   194 DAAYCSRSFHAYMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSPG 258
            ....|.|.... ::.:.||||....|:|.|||||||.....|:|..|..|.|:.|.|...|...|
  Fly   195 PQWSCERPGRP-LDISYICAGSYISDSCKGDSGGPLSAIRTFEGQGRVFQFGVASQGLRLCSGLG 258

  Fly   259 VYTYVPNYINWI 270
            :||.|.::.:||
  Fly   259 IYTNVTHFTDWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 82/237 (35%)
Tryp_SPc 42..272 CDD:238113 83/238 (35%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 82/237 (35%)
Tryp_SPc 45..270 CDD:238113 81/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.