DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG30286

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:278 Identity:106/278 - (38%)
Similarity:158/278 - (56%) Gaps:18/278 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WFVIAICLIRQQRIVDAQFLNPLCGVTYESQTAMRVVNGK-EAVIRSAPFMVYVTNNSLTHCGGS 70
            |.::...|:.......||||.|.||  |.|..|::  |.: :|.|..:|:|.|:..:....|||:
  Fly     3 WILLLTSLLPWHPHATAQFLEPDCG--YMSPEALQ--NEEHQAHISESPWMAYLHKSGELVCGGT 63

  Fly    71 ILNSRYILTAAHCV--FPNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVN 133
            ::|.|:|||||||:  ..||.:||||.|..|..||.||:|.|.||::.|..|..|..|:..|.::
  Fly    64 LVNHRFILTAAHCIREDENLTVRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYSRTNRIH 128

  Fly   134 DIALLKLNRSINFNVHIQPICILLNPASAPS-------VATYQTFGWGETKKNGFPHLLQTAELR 191
            ||.||:|.:|:.:.|||:|||::.|....|.       |||    |||.:......|:|::..:.
  Fly   129 DIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLHRLVAT----GWGRSPSEAANHILKSIRVT 189

  Fly   192 AYDAAYCSRSFHAYMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQS 256
            ..:...||:::......:|||..||...:|:||||||:...:..||...::|:||||||..:|.|
  Fly   190 RVNWGVCSKTYWVDRRRDQICVSHESGVSCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAECLS 254

  Fly   257 PGVYTYVPNYINWIRRAM 274
            |.|:|.|..:|:||..|:
  Fly   255 PSVFTNVMEHIDWIMAAL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 91/238 (38%)
Tryp_SPc 42..272 CDD:238113 93/239 (39%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 91/233 (39%)
Tryp_SPc 39..268 CDD:214473 90/232 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463302
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.