Sequence 1: | NP_725489.2 | Gene: | CG30087 / 246446 | FlyBaseID: | FBgn0050087 | Length: | 277 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_505421.3 | Gene: | try-5 / 187088 | WormBaseID: | WBGene00006623 | Length: | 327 | Species: | Caenorhabditis elegans |
Alignment Length: | 272 | Identity: | 67/272 - (24%) |
---|---|---|---|
Similarity: | 108/272 - (39%) | Gaps: | 49/272 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 LCG--VTYESQTAMRVVNGKEAVIRSAPFMVYV-----TNNSLTHCGGSILNSRYILTAAHCVFP 86
Fly 87 NLRLRL--GEHNIRTDPDCQ------------------GSNCSPRSEEYGIMK------------ 119
Fly 120 -AITHRFYNAANHVNDIALLKLNRSINFNVHIQPICI-LLNPASAPSVATYQTFGWGETKKNGFP 182
Fly 183 H----LLQTAELRAYDAAYCSRSFHAYMNGNQICAGHEE-RDTCAGDSGGPLVTRVDFDGVKRYL 242
Fly 243 QLGIVSYGPTDC 254 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30087 | NP_725489.2 | Tryp_SPc | 41..270 | CDD:214473 | 61/258 (24%) |
Tryp_SPc | 42..272 | CDD:238113 | 61/257 (24%) | ||
try-5 | NP_505421.3 | Tryp_SPc | 48..296 | CDD:389826 | 59/250 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24260 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |