DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and try-3

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001367393.1 Gene:try-3 / 183420 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans


Alignment Length:270 Identity:71/270 - (26%)
Similarity:123/270 - (45%) Gaps:42/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LCGVTYESQTAMRVVNGK---EAVIRSAPFMVYVTNNSLTHCGGSILNSRYILTAAHCVFPNLRL 90
            ||..:|:...:.|::.|.   :.....|..:.|..|.....||.::::..:::|||||.   |:|
 Worm    25 LCEESYKPIFSFRIIGGNSIDDGANWMAKLVSYGDNGQGILCGATVIDDFWLVTAAHCA---LQL 86

  Fly    91 RLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVHIQPICI 155
            :........:|.      :.|...:.:.:|..|..||.....||||||:::..:: .:.|:|:|:
 Worm    87 QTRSFVYVREPK------NNRERSFSVKEAYIHSGYNNQTADNDIALLRISSDLS-KLGIKPVCL 144

  Fly   156 LLNPASAPSVATYQ---TFGWGET---KKNGFPHLLQTAELRAYDAAY-----CSRSFH------ 203
            :.:.:..  :..|:   ..|:|.|   ..:|.|.|:.:..|::.....     |.:::.      
 Worm   145 VHDDSKL--LKQYKNGVVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSLLS 207

  Fly   204 AYMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQS-------PGVYT 261
            ..:.|.|||||.....|..|||||||:.... :|  .|:|:||.|||......       |||||
 Worm   208 VKITGYQICAGAYLHGTAPGDSGGPLLIHKS-NG--EYVQIGITSYGADGLDGVIDQGKFPGVYT 269

  Fly   262 YVPNYINWIR 271
            .:..|:.||:
 Worm   270 RISKYVPWIQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 66/255 (26%)
Tryp_SPc 42..272 CDD:238113 67/257 (26%)
try-3NP_001367393.1 Tryp_SPc 38..279 CDD:238113 66/255 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.