DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and LOC1281782

DIOPT Version :10

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_321740.6 Gene:LOC1281782 / 1281782 VectorBaseID:AGAMI1_003754 Length:301 Species:Anopheles gambiae


Alignment Length:59 Identity:16/59 - (27%)
Similarity:19/59 - (32%) Gaps:19/59 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 VVCAIIGAIVHYNTI--VHPYLLADNRH-----------------YTFYLWNRFFGRWW 326
            ||.|:..|.|...|:  |||..|..:..                 ||..|.....|.||
Mosquito     5 VVLALALAAVSAETVQQVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGNGGWW 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 42..272 CDD:238113
LOC1281782XP_321740.6 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.