DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and LOC1281744

DIOPT Version :10

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_061519534.1 Gene:LOC1281744 / 1281744 VectorBaseID:AGAMI1_004580 Length:722 Species:Anopheles gambiae


Alignment Length:43 Identity:10/43 - (23%)
Similarity:19/43 - (44%) Gaps:3/43 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IPLVCLLGYSIVSFAVFNKV--YETSQQVIDEEFHLRQGDHYC 46
            :||..|.| .:::...::|.  :|.......|.:.|.:|...|
Mosquito     9 LPLTDLTG-CLINHQTYDKCGKFEMKMMECFEAYGLERGKREC 50

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 42..272 CDD:238113 2/5 (40%)
LOC1281744XP_061519534.1 None

Return to query results.
Submit another query.