DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG43124

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:275 Identity:72/275 - (26%)
Similarity:114/275 - (41%) Gaps:54/275 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WFVIAICLIRQQRIVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTHCGGSI 71
            |.|:.|.|:..|.  .||.|...| |.:     |..:||..    .||::..:.::|...|.|::
  Fly     6 WIVLCIVLMFYQG--SAQTLEEDC-VDH-----MERINGSS----YAPWLAEILSDSKVICAGAL 58

  Fly    72 LNSRYILTAAHCVFPN--LRLRLGEHNIRTDPDCQGSNCSPRS-EEYGIMKAITHRFYNAANHVN 133
            :|:.|:||||.|...|  |.:||            ||....:| |.:.:.||.....:..||:.|
  Fly    59 INNLYVLTAASCFKENEKLTVRL------------GSGYFDKSYENFRVTKAYFWMTHFPANNTN 111

  Fly   134 DIALLKLNRSINFNVHIQPICILLNPASAPSVATYQTFGWGETKKNGFPHLLQTAELRAYDAAYC 198
            ::.:.:|...:.|..||:|:||..:|.|.....|::..       |..|.:....  :.....:|
  Fly   112 NLCIFRLQTEVEFKTHIRPMCITKSPKSLGLATTFEII-------NEKPKMWYFC--KNIKGLFC 167

  Fly   199 SRSFHAYMNGNQICAGHEERDTCAGDSGGP---LVTRVDFDGVKRYLQLGIVSYGPTDCQSPGVY 260
            ...|           |..|....:..:|.|   .::...|.|:.||   ||:||........ ||
  Fly   168 KYVF-----------GENEEKWQSKPTGSPWTETISNGPFKGLVRY---GILSYRDNKTYDE-VY 217

  Fly   261 TYVPNYINWIRRAML 275
            ..|.::||||.:..|
  Fly   218 INVMSHINWIAQISL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 58/234 (25%)
Tryp_SPc 42..272 CDD:238113 60/235 (26%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 29/103 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.