DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and zgc:123217

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:261 Identity:84/261 - (32%)
Similarity:126/261 - (48%) Gaps:30/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRDQI--L 87
            ||...::.:|:.|.:|..|:.||...| .||::.    :|||||||.|:|::|||||....|  .
Zfish    28 CGVAPLNTRIVGGTDAPAGSWPWQVSI-HYNNRH----ICGGTLIHSQWVMTAAHCIINTNINVW 87

  Fly    88 AVRLGEHSSSRYFA--------VTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIITDP 144
            .:.||..:.|...|        :.....:..|.....:|||.::::...|.|:..|||||:..:.
Zfish    88 TLYLGRQTQSTSVANPNEVKVGIQSIIDHPSFNNSLLNNDISLMKLSQPVNFSLYIRPICLAANN 152

  Fly   145 TKVPNVKTFKAAGWGKTEN-------ETFSKVLKTVELNELNASECYNMLWVNVTESQICAGHPD 202
            :...|..:..|.|||....       :|..:|...|..|.|.::|..::....:|...||||..:
Zfish   153 SIFYNGTSCWATGWGNIGKDQALPAPQTLQQVQIPVVANSLCSTEYESVNNATITPQMICAGKAN 217

  Fly   203 GDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSL-C---NSPGVYTRLSSFIDWILMVVDNYT 263
            ..||.||||||.   ....||: ::|.||.|:|:|. |   ..|.||:|:|.|..||.|.|....
Zfish   218 KGTCQGDSGGPF---QCKQGSV-WIQAGITSYGTSAGCAVGAYPDVYSRVSEFQSWIKMNVQGSA 278

  Fly   264 V 264
            :
Zfish   279 I 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 78/242 (32%)
Tryp_SPc 34..255 CDD:238113 78/241 (32%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 78/242 (32%)
Tryp_SPc 37..273 CDD:238113 80/244 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.