DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG18754

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:307 Identity:86/307 - (28%)
Similarity:136/307 - (44%) Gaps:81/307 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLWPGAMSQ-----FLEPNCGYPDISPKIMH------------------------------GQNA 40
            :|.|..|:|     |....||......:::|                              .:||
  Fly    48 ILRPRGMTQAEKDVFAHRQCGLDPNGHELLHMVYVCCPELGDVLPNKQTCGQTTPVFRDRGAENA 112

  Fly    41 ENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCI------KRDQIL-AVRLGEHSSSR 98
            |....|||..:...|...:.           ::||:||||:      :.|.:| :|||||.::. 
  Fly   113 ELNEYPWMVLLLYENRLSLI-----------RYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTD- 165

  Fly    99 YFAVTKAFR-------------NKYFTT--GSYSNDIGILRIQPIVKFNAVIRPICIITDPTKVP 148
              .:|...|             ::.||:  |:|.|||.:||:|..|::...|:|||::.....:.
  Fly   166 --CITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQ 228

  Fly   149 NVKTFKAAGWGKTENETFSKVLKTVELNELNASECYNMLWVNVTESQICA-GHPDGDTCAGDSGG 212
            :: ..:.:||..|::   |:.|.|..:.|.|.::|.|......:.||:|| |...||||||.||.
  Fly   229 DL-NLQISGWDPTKS---SQTLITSTVKERNPADCLNRYPSFRSASQVCAGGQRKGDTCAGISGS 289

  Fly   213 PLIHPVYMDGSLRYVQL-GIISFGSSLCNS---PGVYTRLSSFIDWI 255
            |:: .:...|...:|.| ||.|:|...|.|   |||||::..|.:||
  Fly   290 PVM-GIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 77/278 (28%)
Tryp_SPc 34..255 CDD:238113 77/277 (28%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855 8/35 (23%)
Tryp_SPc 108..338 CDD:238113 78/247 (32%)
Tryp_SPc 108..335 CDD:214473 76/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463555
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.