DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG18735

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:259 Identity:82/259 - (31%)
Similarity:133/259 - (51%) Gaps:31/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AMSQFLEPNCGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHC 80
            |..:..|.:||..:...:|:.||..|....|||..:..:.:     ..||.:|::.|:.|:||||
  Fly    65 AKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGN-----FYCGASLVNDQYALTAAHC 124

  Fly    81 IK--RDQILAVRLGEHSSSRYFA------VTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRP 137
            :.  ..:::.|||.||:......      |::...:..::|.::.:||.::|....|:....:.|
  Fly   125 VNGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHP 189

  Fly   138 ICIITDPTKVPNV--KTFKAAGWGK-TENETFSKVLKTVELNELNASECYNMLW--VNVTESQIC 197
            :|:   ||...|.  :|....|||. :|....|..|:.||:..|:..||.|..:  ..:|::.||
  Fly   190 VCM---PTPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMIC 251

  Fly   198 AGHPD---GDTCAGDSGGPLIHPVYMDGSLRYVQL-GIISFGSSLC--NSPGVYTRLSSFIDWI 255
            ||:.:   .|:|.||||||:    ::.||....|| ||:|:|....  |:||||||:.||.|||
  Fly   252 AGYVEQGGKDSCQGDSGGPM----HVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 76/240 (32%)
Tryp_SPc 34..255 CDD:238113 76/239 (32%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 76/240 (32%)
Tryp_SPc 83..314 CDD:238113 78/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.