DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG34409

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:282 Identity:90/282 - (31%)
Similarity:135/282 - (47%) Gaps:50/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AMSQFLEPN---CGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELV--CGGTLIHKQFVL 75
            :|..|.:.|   ||. ::..:::.|..|..|..||:..| .|.::..:.:.  |.|:||....::
  Fly   230 SMPPFAQENTQGCGI-NVESRLLGGDQASAGQFPWLTRI-AYRNRSSSRISFRCSGSLISSNHIV 292

  Fly    76 SAAHCIKR---D-QILAVRLGEHSSSRYFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIR 136
            :||||:..   | ::..||||....:..||:.:...:..:....|:|||.:|||.   ..|....
  Fly   293 TAAHCVVNLVSDLELSHVRLGSQDGATPFAIEQVIVHPNYDQPKYANDIALLRIN---STNGTFT 354

  Fly   137 PICI-ITDPTKVPN---VKTFKAAGW--GKTENET------FSKVLKTVELNELNASEC---YNM 186
            |||: ...|..:.|   .:...||||  |.|||.:      .:..::.:.|..:|.:.|   |..
  Fly   355 PICLPFNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYAS 419

  Fly   187 LWVN------VTESQICA-GHPDGDTCAGDSGGPLIHPVYMDG-------SLRYVQLGIISFGSS 237
            |..|      :|.:.:|| |.|..|.|.||||||.:.    ||       |.||..:||::||.:
  Fly   420 LSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMD----DGTSGVFGTSGRYTIIGIVAFGPT 480

  Fly   238 LC---NSPGVYTRLSSFIDWIL 256
            ||   ..|||||.:|||.||||
  Fly   481 LCGVTTIPGVYTLVSSFSDWIL 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 82/259 (32%)
Tryp_SPc 34..255 CDD:238113 82/258 (32%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 82/259 (32%)
Tryp_SPc 252..501 CDD:238113 82/256 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463560
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.