DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG34171

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:301 Identity:72/301 - (23%)
Similarity:117/301 - (38%) Gaps:59/301 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FTIFKIILLWPG-----AMSQFLEPNCGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELV 63
            |.:.||.|:.|.     .::.:.||.  |..:|..::..:..:        ||....|..    .
  Fly     6 FLLLKIALVLPKNITTIKINHYHEPT--YSHLSSYLVSLRTRK--------YIHTPGDNH----F 56

  Fly    64 CGGTLIHKQFVLSAAHCI----------KRDQI-LAVRLGEHSSSRYFAVT--KAFRNKYFTTGS 115
            |.|.::..:.||::||||          ||..: |...|.:...|..|.|.  ....:.|:....
  Fly    57 CTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPYYHRNQ 121

  Fly   116 YSNDIGILRIQPIVKFNA-VIRPICIITDPTKVPN-VKTFKAAGWGKTENETF----SKVLKTVE 174
            : |||.|::::..||.:. .:.|:.:.....:|.| .||.  .|......:.|    |.:|..||
  Fly   122 H-NDIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTI--GGIFGVRRQRFGSFHSMLLVNVE 183

  Fly   175 LNELNASECYN-----MLWVNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISF 234
            |...:  ||..     |......|..||....:...|..|.||||    :.||.|..:.||.|: 
  Fly   184 LRPFD--ECLKVKKSLMAARPENEDLICVKSTEKQMCTTDFGGPL----FCDGQLYGIALGSIN- 241

  Fly   235 GSSLCNSPG--VYTRLSSFIDWILMVVDNYTVRSPPKIQYR 273
                |:||.  .::.:|.:..|:..::......:.|.|..|
  Fly   242 ----CSSPDPVFFSDVSFYNSWVTKIISEAVDHTRPFIADR 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 59/247 (24%)
Tryp_SPc 34..255 CDD:238113 59/246 (24%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 63/258 (24%)
Tryp_SPc 38..263 CDD:304450 60/250 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436658
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.