DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:265 Identity:87/265 - (32%)
Similarity:131/265 - (49%) Gaps:49/265 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGYPD--ISPKIMHGQNAENGTNPWMAYI-FKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRDQI 86
            ||.|:  ::|:|:.|.||.:|..|||..: .:|..      .|||:||:.|:||:|||||. ||.
Zfish    25 CGRPNPTLNPRIVGGVNATHGAWPWMVSLQGRYGH------FCGGSLINNQWVLTAAHCIV-DQT 82

  Fly    87 ---LAVRLGEHSSSRYFA----VTKAFRNKYFTTGSYS-----NDIGILRIQPIVKFNAVIRPIC 139
               :.|.||:..|  |.|    :::..|: .....|||     |||.:|::...|::...|:|||
Zfish    83 PSSIIVYLGKWRS--YVADVNSISRTIRH-IIPHPSYSNITKDNDIALLQLTSTVQYTDYIKPIC 144

  Fly   140 IITDPTKVPNVKTFKAAGWGK---------TENETFS------KVLKTVELNELNASECYNMLWV 189
            :..:.:..|.......||||.         ....|.|      .:|:..||...:.::|.|:...
Zfish   145 LADENSNFPRGTNSWVAGWGDIGVLGTGGIRGRTTVSVPLPHPGILQEAELKVYSNADCNNICHG 209

  Fly   190 NVTESQICAG-HPDGD-TCAGDSGGPLIHPVYMDGSLRYVQLGIIS--FGSSLCNSPGVYTRLSS 250
            .:|.:.|||| .|.|. |.:|||||||     |.....:||.|::|  :|.:..|.|.|:.|:|.
Zfish   210 RITPNMICAGTRPGGKATFSGDSGGPL-----MTKCSVWVQAGVLSHGYGCAQPNLPEVFIRVSE 269

  Fly   251 FIDWI 255
            :..||
Zfish   270 YKQWI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 81/253 (32%)
Tryp_SPc 34..255 CDD:238113 81/252 (32%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 81/252 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.