DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and zgc:112038

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:291 Identity:93/291 - (31%)
Similarity:139/291 - (47%) Gaps:70/291 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FIFTIFKIILLWPGAMSQFLEPNCGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGG 66
            |::....::|...||:.|.  ..||...::.. ..|.:|..|:.||.|.|.:.:.:   :.:|||
Zfish     6 FVYVGEFLLLNIAGALCQL--DVCGQAPLNNN-NGGDDAVAGSWPWQASIHRISPE---DHICGG 64

  Fly    67 TLIHKQFVLSAAHCIKRDQILAVRLGEHSSSRYFAVT-----KAFRNKYFTTGS----------- 115
            :||:|.:|||||||                   |.:|     |.|..:.|.|||           
Zfish    65 SLINKDWVLSAAHC-------------------FMITATANIKIFLGRQFQTGSNPNEISRTLTQ 110

  Fly   116 ------YS-----NDIGILRIQPIVKFNAVIRPICIIT-DPTKVPNVKTFKAAGWGKTENETF-- 166
                  ||     |||.:||:...|.|...|||:|:.: |.......|:: ..||.|..:...  
Zfish   111 IVIHPDYSTTTQNNDIALLRLSSSVTFTDYIRPVCLASADSVFAGGTKSW-ITGWDKHRSSDIQV 174

  Fly   167 SKVLKTVELNELNASEC---YNMLWVNVTESQICAGHPDG--DTCAGDSGGPLIHPVYMDGSLRY 226
            :.||:.|:|..::.:||   |..:   :|::.||||..:|  |.|.||||||:   |..:|| |:
Zfish   175 TNVLQEVQLPVVSNTECNADYKGI---ITDNMICAGINEGGKDACQGDSGGPM---VSQNGS-RW 232

  Fly   227 VQLGIISFG--SSLCNSPGVYTRLSSFIDWI 255
            :|.||:|||  ..|...||:|||:|.:..||
Zfish   233 IQSGIVSFGRECGLPRYPGIYTRVSQYQSWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 84/258 (33%)
Tryp_SPc 34..255 CDD:238113 84/257 (33%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 84/255 (33%)
Tryp_SPc 37..263 CDD:238113 84/255 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.