DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG11313

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:245 Identity:75/245 - (30%)
Similarity:125/245 - (51%) Gaps:45/245 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 WMAYI-FKYNDKEVAELVCGGTLIHKQFVLSAAHCI------KRDQI---LAVRLGEHSSSR--- 98
            ||..: ::.:|.:.....|.|:||:.::|::||||:      ::..:   ::||||||::|.   
  Fly   129 WMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVD 193

  Fly    99 -----------YFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIITDPTKV----- 147
                       ..||.:...::.|.|..:.|||.::|:...|.::..|||:|:   |:.|     
  Fly   194 CLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLAREVAYSPSIRPVCL---PSTVGLQNW 255

  Fly   148 PNVKTFKAAGWGKTENETFSKVLKTVELNELNASEC---YNMLWVNVTESQICA-GHPDGDTCAG 208
            .:.:.|..||||:|.....|.|...:.:..:....|   |..: |.:.:|.:|| |...||:|.|
  Fly   256 QSGQAFTVAGWGRTLTSESSPVKMKLRVTYVEPGLCRRKYASI-VVLGDSHLCAEGRSRGDSCDG 319

  Fly   209 DSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNS---PGVYTRLSSFIDWI 255
            ||||||:  .:.:|.  :|..||:|||.: |.|   |.|||.:.|:..||
  Fly   320 DSGGPLM--AFHEGV--WVLGGIVSFGLN-CGSRFWPAVYTNVLSYETWI 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 73/243 (30%)
Tryp_SPc 34..255 CDD:238113 73/243 (30%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 75/245 (31%)
Tryp_SPc 116..364 CDD:214473 73/243 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.