DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and Jon99Fii

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:243 Identity:67/243 - (27%)
Similarity:119/243 - (48%) Gaps:34/243 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ISPKIMHGQNAENGTNPW-MAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRDQILAVRLG- 92
            |..:|.:|..|..|..|: :..:|..|    ....|||::|...:||:||||......:.:..| 
  Fly    34 IQGRITNGYPAYEGKVPYIVGLLFSGN----GNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGA 94

  Fly    93 ----EHSSSRYFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIITDPTKVPNVKTF 153
                :...:.:.......::.::.:|:..|||.::| .|.|.|..::..:.:   |:.....:.:
  Fly    95 SLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIR-TPHVDFWHLVNKVEL---PSYNDRYQDY 155

  Fly   154 K-----AAGWGKT-ENETFSKVLKTVELNELNASECYNMLWVNVTESQICAGHPDG-DTCAGDSG 211
            .     |:|||.| :.......|:.|::..::.|:| :..| ::.::.||.....| .||.||||
  Fly   156 AGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDC-SRSW-SLHDNMICINTNGGKSTCGGDSG 218

  Fly   212 GPLI-HPVYMDGSLRYVQLGIISFGSSL-CNS--PGVYTRLSSFIDWI 255
            |||: |    :|: |.|  |:.||.||. |.|  |.|::|::.::|||
  Fly   219 GPLVTH----EGN-RLV--GVTSFVSSAGCQSGAPAVFSRVTGYLDWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 64/238 (27%)
Tryp_SPc 34..255 CDD:238113 64/237 (27%)
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 64/238 (27%)
Tryp_SPc 38..262 CDD:238113 66/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435998
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.