DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG9733

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:275 Identity:84/275 - (30%)
Similarity:142/275 - (51%) Gaps:55/275 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PNCGYPDISPKIMHGQNAENGTNPWMAYI-FKYNDKEVAELVCGGTLIHKQFVLSAAHC----IK 82
            |:||...|..:|..||:.:....|||..: ::..........|.|:||::::||:||||    |:
  Fly   151 PSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIE 215

  Fly    83 RD--QILAVRLGEHSSS---------------------RYFAVTKAFRNKYFTTGSYSNDIGILR 124
            |:  .:::||||||.:.                     ....|.:.:..|   ..:..:|||::|
  Fly   216 REVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEK---ASNQVHDIGLIR 277

  Fly   125 IQPIVKFNAVIRPICIITDPTKV-----PNVKTFKAAGWGKTENETFSKVLKTVELNELNASEC- 183
            ::..|:::..|:|||:   |:.|     .:.:.|..||||:|.....|.|.:.|.:|.::.::| 
  Fly   278 MERNVRYSDNIQPICL---PSSVGLESRQSGQQFTVAGWGRTLKMARSAVKQKVTVNYVDPAKCR 339

  Fly   184 --YNMLWVNVTESQICAGHPDG----DTCAGDSGGPLIHPVYMDGSLRYVQLGIISFG--SSLCN 240
              ::.:.||:..:|:|||   |    |:|.|||||||:.  :.|.|  :|..||:|||  ..|.:
  Fly   340 QRFSQIKVNLEPTQLCAG---GQFRKDSCDGDSGGPLMR--FRDES--WVLEGIVSFGYKCGLKD 397

  Fly   241 SPGVYTRLSSFIDWI 255
            .|||||.::::..||
  Fly   398 WPGVYTNVAAYDIWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 78/263 (30%)
Tryp_SPc 34..255 CDD:238113 78/262 (30%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 78/263 (30%)
Tryp_SPc 162..415 CDD:238113 80/264 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.