DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG11843

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:273 Identity:88/273 - (32%)
Similarity:134/273 - (49%) Gaps:39/273 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LWPGAM--SQFLEPNCGYPDISPKIMHGQNAENGTNPWMAYIFKYND-KEVAELVCGGTLIHKQF 73
            |.|||.  |:.:: ||  ...:|.|:.|..|:....|.||.:.:..| ...|:..|||.||.::|
  Fly    47 LLPGASIESRIID-NC--RSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERF 108

  Fly    74 VLSAAHCI--KRDQILAVRLG--------EHSSSRYFAVTKAFRNKYFTTGSYSNDIGILRIQPI 128
            ||:||||:  :|.::..||||        |.::.|.:.|.....:..:....:.:|||::::...
  Fly   109 VLTAAHCLESERGEVNVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEA 173

  Fly   129 VKFNAVIRPICIITDPTKVPNVKTFKAAGWGKT--ENETFSKVLKTVELNELNASECYNMLWVNV 191
            |.|:....|.|:.....:  :..:|.|.|||.|  ..:..:::|| |:|.......|..:|...|
  Fly   174 VVFDLYKHPACLPFQDER--SSDSFIAVGWGSTGLALKPSAQLLK-VKLQRYGNWVCKKLLTRQV 235

  Fly   192 TE--------SQICAGHPDG-DTCAGDSGGPLI--HPVYMDGSLRYVQLGIISFGSSLCNS---P 242
            .|        :|:|.|.... |||.|||||||:  |..|   ...||.:||.|.|.| |.|   |
  Fly   236 EEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLMYHREY---PCMYVVVGITSAGLS-CGSPGIP 296

  Fly   243 GVYTRLSSFIDWI 255
            |:|||:..::.||
  Fly   297 GIYTRVYPYLGWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 78/248 (31%)
Tryp_SPc 34..255 CDD:238113 78/247 (32%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 80/249 (32%)
Tryp_SPc 68..309 CDD:214473 78/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437568
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.