DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG11841

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:246 Identity:80/246 - (32%)
Similarity:116/246 - (47%) Gaps:27/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCI--KRDQILAVRLGE- 93
            |.|:.|..||....|:.|.:.........:..||||||..:.||:||||.  :..::..||||| 
  Fly    70 PLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGEL 134

  Fly    94 -------HSSSRYFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIITDPTKVPNVK 151
                   .:....|.|.....:..|......|||||:::...||||....|.|:..|..:  ..:
  Fly   135 EFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGE--QHE 197

  Fly   152 TFKAAGWG-KTENETFSKVLKTVELNELNASECYNMLWVN-------VTESQICAGHPDG-DTCA 207
            :|.|.||| |...:..||.|..|:|.... ..|.:.:..|       ..:||:|.|..|. |||.
  Fly   198 SFIAIGWGQKKFAQKESKKLLKVQLQGYK-DRCVSSVDANDELPNGYEPKSQLCIGSRDNKDTCN 261

  Fly   208 GDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNSPGV---YTRLSSFIDWI 255
            ||||||:: ..:.|.:..|..:||.|.|.: |::|.:   |||:..|::||
  Fly   262 GDSGGPVL-AYHKDLACMYHVMGITSAGIT-CSTPDIPSAYTRVHYFLNWI 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 77/243 (32%)
Tryp_SPc 34..255 CDD:238113 77/242 (32%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 79/244 (32%)
Tryp_SPc 72..310 CDD:214473 77/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437567
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.