DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and aqrs

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster


Alignment Length:284 Identity:51/284 - (17%)
Similarity:93/284 - (32%) Gaps:90/284 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRDQILAVRLGEHSSSRYFAVTKAFRNKYFT-- 112
            |:...|:..|   :|.|.||.::.|:::.||.:              .|.|.:...:..|:.:  
  Fly    78 YVNVLNEGSV---ICAGALISRRMVVTSTHCFQ--------------PRRFDLIYEYTAKHLSIL 125

  Fly   113 TGSYSND-------IGILRIQPIVKFNAVIRPICIITDPTKVPNVK---------------TFKA 155
            ||...:|       ||.  ..|:.|.......:.::....|:...|               ..|.
  Fly   126 TGVELDDNPEPHQVIGF--FMPVNKNERFTNYVALLALSNKLDRDKYRYIPLHRKKPQAGDDVKM 188

  Fly   156 AGWGKTENETFSKVLKTVELNELNASECY----NMLWVNVTESQ-ICA---GHPDGDTCAGDSGG 212
            |.:|..:   |...|....:.:::..:.:    .:..|:..|.. ||.   .|....||:...|.
  Fly   189 AYYGPPK---FQIRLYNTRVMDIDRCKIHYGLKEVFHVSTFEPDFICVRNKRHSKKTTCSTRPGD 250

  Fly   213 PLIHPVYMDGSLRYVQL---------------------GIISFGSSLCNS------PGVY----- 245
            ||:    :|..|..:.:                     .:|.|..:..::      .|.|     
  Fly   251 PLL----IDNKLAAINIYGEHCDEDDDSTNMDIYLPIRPVIPFIQTATDALRAFTGSGPYNESYP 311

  Fly   246 TRLSSFIDWILMVVDNYTVRSPPK 269
            |.||..::.|:....|..|..||:
  Fly   312 TTLSPLLEAIVKKSPNVYVGGPPE 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 46/268 (17%)
Tryp_SPc 34..255 CDD:238113 46/268 (17%)
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 39/233 (17%)
Tryp_SPc 83..268 CDD:304450 38/210 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.