DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and grass

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:270 Identity:83/270 - (30%)
Similarity:128/270 - (47%) Gaps:33/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MSQFLEPN--CGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAH 79
            ||.|.:.|  || ..:|.::.:|...:..:.|||| :.:|.....:..:|||.:|.::::|:|||
  Fly   101 MSLFKDENFDCG-NFLSQRVSNGYEVKLSSRPWMA-LLRYQQFGESRFLCGGAMISERYILTAAH 163

  Fly    80 CIK--RDQILAVRLGEHSSSR------------------YFAVTKAFRNKYFTTGSYSNDIGILR 124
            |:.  ::.:..:|||||..|.                  ...:.|...::.:......:||.:|:
  Fly   164 CVHGLQNDLYEIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLK 228

  Fly   125 IQPIVKFNAVIRPICI-ITD--PTKVPNVKTFKAAGWGKTENETFSKVLKTVELNELNASECYNM 186
            :...|.|...|:|||: |||  ..|...:.|:...|||.|||.:.|.||....:.....|.|...
  Fly   229 LNRSVPFQKHIKPICLPITDELKEKAEQISTYFVTGWGTTENGSSSDVLLQANVPLQPRSACSQA 293

  Fly   187 LWVNVTESQICAGHPD-GDTCAGDSGGPLIHPVYMDGSL--RYVQLGIISFGSSLCNS---PGVY 245
            ....|..||:|.|..| .|:|.|||||||..|....|..  :.|:.||:|.|...|..   ||:|
  Fly   294 YRRAVPLSQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLY 358

  Fly   246 TRLSSFIDWI 255
            |.:..::.||
  Fly   359 TNVGEYVQWI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 74/250 (30%)
Tryp_SPc 34..255 CDD:238113 74/249 (30%)
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 76/249 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.