DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG16710

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:304 Identity:99/304 - (32%)
Similarity:145/304 - (47%) Gaps:74/304 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KIILLWPGAMSQFLEPN---CGYPDISP--KIMHGQNAENGTNPWMAYIF-------KYNDKEVA 60
            ::::..|. |...| ||   ||  .|.|  :|..|:..:....||||.|.       .:|::.|:
  Fly    79 RVLICCPN-MGHIL-PNTQICG--PIMPAYRIFGGEETQPNELPWMALILYAHRSRSVWNERLVS 139

  Fly    61 ELVCGGTLIHKQFVLSAAHCIKRD--QILAVRLGEHS---------------------------- 95
            .  |.|:||..::||:||||::..  .:..||||||:                            
  Fly   140 R--CAGSLITNRYVLTAAHCLRITGLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEIDVDL 202

  Fly    96 --SSRYFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPIC-----IITDPTKVPNVKTF 153
              ..|::.|        |....| |||.:||::..|::.|.|:|||     |.::|: ..|.| .
  Fly   203 SIKHRHYMV--------FEERPY-NDIALLRLKFPVRYTAQIKPICVQLDYIFSNPS-FSNHK-L 256

  Fly   154 KAAGWGKTENETFSKVLKTVELNELNASEC---YNMLWVNVTESQICAGHPDG-DTCAGDSGGPL 214
            :.||||.:..:.:|.||....:|..||.||   ...|.:: .|:.||||:..| |||.|||||||
  Fly   257 QIAGWGLSHKQGYSNVLLQAYVNGRNADECSLSEPSLGLD-KETHICAGNLGGNDTCKGDSGGPL 320

  Fly   215 IHPVYMDGSLRYVQL-GIISFGSSLCN-SPGVYTRLSSFIDWIL 256
            : .:...|...:|.| ||.|:|.|.|. .|..||:.|.|::|||
  Fly   321 M-AIMERGDEEFVYLAGITSYGYSQCGYGPAAYTKTSKFVEWIL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 87/271 (32%)
Tryp_SPc 34..255 CDD:238113 87/270 (32%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 0/4 (0%)
Tryp_SPc 105..362 CDD:214473 87/271 (32%)
Tryp_SPc 106..362 CDD:238113 87/270 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463556
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.