DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG31219

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:274 Identity:95/274 - (34%)
Similarity:136/274 - (49%) Gaps:49/274 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAEL-VCGGTLIHKQFVLSAAHC---IKRD- 84
            ||....:.:::.|..|.....||||.:...|...:..| .|.|:||:.::||::|||   |.|| 
  Fly    80 CGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDL 144

  Fly    85 QILAVRLGEHSSSRYFAVTKAFRN---------------KYFTTGSYSN--------DIGILRIQ 126
            .:.:||||||..:...|.....|:               |....|.:|:        ||.:||::
  Fly   145 SLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLK 209

  Fly   127 PIVKFNAVIRPICIITDPTKVPNVKTF-----KAAGWGKTENETFSKVLKTVELNELNASEC-YN 185
            ..|::...|.||||       |....|     :.||||||....||:||....:.|.:.:.| ..
  Fly   210 MPVRYRTGIMPICI-------PKHGFFAKSKLEIAGWGKTNEGQFSQVLMHGFIRERSIAVCALR 267

  Fly   186 MLWVNVTES-QICAGHPDG-DTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNS---PGVY 245
            ..::::.:| |||||..|| |||.|||||||:  |.||.|..|: .||.::||..|..   ||:|
  Fly   268 FPYLDLNQSLQICAGGYDGVDTCQGDSGGPLM--VTMDNSSVYL-AGITTYGSKNCGQIGIPGIY 329

  Fly   246 TRLSSFIDWILMVV 259
            ||.|:|:.||..|:
  Fly   330 TRTSAFLPWIKAVL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 90/260 (35%)
Tryp_SPc 34..255 CDD:238113 90/259 (35%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 90/260 (35%)
Tryp_SPc 90..342 CDD:238113 92/261 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463552
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.