DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG7142

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:224 Identity:55/224 - (24%)
Similarity:99/224 - (44%) Gaps:26/224 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CGGTLIHKQFVLSAAHCIKRDQILAVRL------------GEHSSSRYFAVTKAFRNKYFTTGSY 116
            |.||:|::.::|:||||:...|.:...:            ||.|:.:...:....|::.:..|..
  Fly   110 CAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLGGVN 174

  Fly   117 SNDIGILRIQPIVKFNAVIRPICIITDPTKVPNVKTFKAAGWGK---TENETFSKVLKTVELNEL 178
            ..||.::..:..:.|:..::|..:.....:.....|.  .|||.   |....:...|:...:..|
  Fly   175 PYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYGTL--YGWGNVSMTAVPNYPHRLQEANMPIL 237

  Fly   179 NASECYNML---WVNVTESQICAGHPDG--DTCAGDSGGPLIHPVYMDG-SLRYVQLGIISFGSS 237
            :...|..:|   .:.:.|:.:|.|...|  ..|..|||||||.....:. ....:.:||:|:|..
  Fly   238 DMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKM 302

  Fly   238 LC---NSPGVYTRLSSFIDWILMVVDNYT 263
            .|   |:|.|:.|:|:|.:||..|:...|
  Fly   303 PCGQKNAPSVFVRVSAFTEWINQVISTAT 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 51/214 (24%)
Tryp_SPc 34..255 CDD:238113 51/214 (24%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 53/217 (24%)
Tryp_SPc 84..323 CDD:214473 51/214 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.