DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG5255

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:272 Identity:64/272 - (23%)
Similarity:119/272 - (43%) Gaps:43/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IFTIFKIILLWPGAMSQFLEPNCGYPDISP-KIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGG 66
            :..:..::|....|.||.|.|    |..:. :|:.|:.|..|..|:...:........:   |||
  Fly     2 LLILLPLVLFTSSAASQILYP----PQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHS---CGG 59

  Fly    67 TLIHKQFVLSAAHCIKRDQILAVRL--G----EHSSSRYFAVTKAFRNKYFTTGSYSNDIGILRI 125
            .:|.::::::||||.:..|..|.|:  |    ..:.|:|:...:...:..:....|.|||.:|.:
  Fly    60 AIIDERWIITAAHCTRGRQATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHL 124

  Fly   126 QPIVKFNAVIRPICIITDPTKVPNVKTFKAAGWGKTENETFS------KVLKTVELNELNASECY 184
            ...:.|:...:|: .:.....||..:.. ..|||     |.|      ..|:::|:|.:...:|.
  Fly   125 NESIVFDNATQPV-ELDHEALVPGSRLL-LTGWG-----TLSLGGDVPARLQSLEVNYVPFEQCR 182

  Fly   185 ----NMLWVNVTESQICAGHPDG-DTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNS-PG 243
                |...|::  ..:|..:..| ..|.|||||||:|    :|.|    :.::::|...... |.
  Fly   183 AAHDNSTRVDI--GHVCTFNDKGRGACHGDSGGPLVH----NGKL----VALVNWGLPCAKGYPD 237

  Fly   244 VYTRLSSFIDWI 255
            .:..:|.:.|:|
  Fly   238 AHASISYYHDFI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 56/239 (23%)
Tryp_SPc 34..255 CDD:238113 56/238 (24%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 56/239 (23%)
Tryp_SPc 30..252 CDD:238113 57/240 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437276
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.