DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG9649

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:280 Identity:77/280 - (27%)
Similarity:130/280 - (46%) Gaps:45/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PGAMSQF-------LEPNCGYPDI--SPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLI 69
            |...|:|       |...||...:  :|.|.:|...|.|..||||.:|::..::. ..:||||||
  Fly   228 PAQASKFYPQTIGQLSGICGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRDY-NFLCGGTLI 291

  Fly    70 HKQFVLSAAHCIK------RDQILAVRLGEH-----SSSRYFAVTKAFRNKYFTTGSYSN-DIGI 122
            ..:.|:|||||.:      ..:...|.||.:     ||.....|.:...::.:....|:: |:.:
  Fly   292 SARTVISAAHCFRFGSRNLPGERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPNVYTDADLAL 356

  Fly   123 LRIQPIVKFNAVIRPICIITDP--TKVPNVKTFKAAGWGKTE-NETFSKVLKTVELNELNASECY 184
            |::...|.....|:|||:..:.  .::|:......||||:.| ....:::.|..:.:.:...||.
  Fly   357 LQLSNHVDIGDYIKPICLWNENFLLELPSGHKSYVAGWGEDEKGNRNTRLAKMTDTDIITQWECR 421

  Fly   185 -NMLWVN---VTESQICAGHPDGD-TCAGDSGGPLI---HPVYMDGSLRYVQLGIISFGSSLCNS 241
             |:...|   :|...|||.:.... .|:|||||.|:   ..::|   ||    |::|.|..:.|.
  Fly   422 GNLSEENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQDIWM---LR----GVVSAGQRMTNR 479

  Fly   242 -----PGVYTRLSSFIDWIL 256
                 |.:||.::..|:|:|
  Fly   480 CNLTLPVIYTDVAKHIEWLL 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 68/249 (27%)
Tryp_SPc 34..255 CDD:238113 68/248 (27%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 68/248 (27%)
Tryp_SPc 259..497 CDD:214473 67/245 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436592
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.