DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG8870

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:349 Identity:96/349 - (27%)
Similarity:144/349 - (41%) Gaps:81/349 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FTIFKIILLWP---GAMSQFLEPNCGYPDISPKIMHGQNAEN---------GTN----------- 45
            |.:...|:|.|   ||..|| :..|...|..|:.....|:..         |||           
  Fly     9 FLLMLQIILVPYSNGAGCQF-DTECVNLDKCPRTRAVMNSSRKNIIGLRRCGTNKVCCPKWETYL 72

  Fly    46 -----------------------PWMAYIFKYNDKEVAELV---CGGTLIHKQFVLSAAHCIKRD 84
                                   ||||.:...|...:::.:   |||:||:..:||:||||::..
  Fly    73 PHDTCGQSRRKPTKGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYP 137

  Fly    85 ------QILAVRLGEHSSS-----------RYFA-------VTKAFRNKYFTTG-SYSNDIGILR 124
                  .:..||||||::|           |.:|       |.:...::.|..| ...|||.::|
  Fly   138 FMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVR 202

  Fly   125 IQPIVKFNAVIRPICIITDPTKVPNVKTFKAAGWGKTENETFSKVLKTVELNELNASECYNMLWV 189
            ::..|::...|:|||:........:.:.|:|:||........|:||....:.|.:...|.:....
  Fly   203 LKFPVRYTRAIQPICLPRAQKLAAHKRKFQASGWPDMGQGIASEVLLRSFIAERHPDVCKSNYDF 267

  Fly   190 NVTESQICAGHPDG-DTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLC----NSPGVYTRLS 249
            |: .||||||..|| ||..|||||||:..|...........||||:|...|    ..|..||:.|
  Fly   268 NL-GSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTKTS 331

  Fly   250 SFIDWILMVVDNYTVRSPPKIQYR 273
            .|.:||...:.:..:.|..|.:.|
  Fly   332 YFFEWIKSKLQSPFIDSDSKSRTR 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 80/297 (27%)
Tryp_SPc 34..255 CDD:238113 80/296 (27%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 78/247 (32%)
Tryp_SPc 93..337 CDD:214473 76/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463557
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.