DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and snk

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:255 Identity:87/255 - (34%)
Similarity:130/255 - (50%) Gaps:42/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PKIMHGQNAENGTNPWMAYI-----FKYNDKEVAELVCGGTLIHKQFVLSAAHCI----KRDQIL 87
            |.|:.|....:|..|.||.:     ....|::: :..|||.|:.:.:||:||||.    |...: 
  Fly   184 PLIVGGTPTRHGLFPHMAALGWTQGSGSKDQDI-KWGCGGALVSELYVLTAAHCATSGSKPPDM- 246

  Fly    88 AVRLGEHSSSRYFAVTKAFR------NKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIITDP-T 145
             ||||....:...|..:..:      :..:.:.:|.:||.:|::...|||:..:||.|:...| .
  Fly   247 -VRLGARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPEL 310

  Fly   146 KVPNVKTFKAAGWGKTENETF----SKVLKTVELNELNASECYNM------LWVNVTESQICAGH 200
            ::|   |..|||||:||   |    |..|:.|:|:.:....|..:      |...:.|.|.|||:
  Fly   311 QIP---TVVAAGWGRTE---FLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGY 369

  Fly   201 -PDG-DTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLC---NSPGVYTRLSSFIDWI 255
             |.| |||.|||||| ||.:..:.:.....:||.||| ..|   |:|||||||.|::|||
  Fly   370 LPGGRDTCQGDSGGP-IHALLPEYNCVAFVVGITSFG-KFCAAPNAPGVYTRLYSYLDWI 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 84/252 (33%)
Tryp_SPc 34..255 CDD:238113 84/251 (33%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 86/253 (34%)
Tryp_SPc 186..427 CDD:214473 84/251 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437447
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.