DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG3916

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:279 Identity:80/279 - (28%)
Similarity:133/279 - (47%) Gaps:36/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIFTIFKIILLWPGAMSQFLEPNCGYPDI------SPKIMHGQNAENGTNPWMAYIFKYNDKEV 59
            |.:..:|.::|:    :.|      |..|:      ||..::|....|.|.|:...: :...:..
  Fly     1 MVVLQLFCMLLI----LRQ------GLADVVTSTTESPTRINGGQRVNETVPFQVSL-QMQRRGR 54

  Fly    60 AELVCGGTLIHKQFVLSAAHCIKRDQI--LAVRLG----EHSSSRYFAVTKAFRNKYFTTGSYSN 118
            .:..|||:::..|.||:||||:::.::  ::|.:|    :....|:..|||....:|.......|
  Fly    55 WQHFCGGSIVSGQHVLTAAHCMEKMKVEDVSVVVGTLNWKAGGLRHRLVTKHVHPQYSMNPRIIN 119

  Fly   119 DIGILRIQPIVKFNAVIRPICIITDPTKVPNVKTFKAAGWGKTENETFSKVLKTVELNELN---- 179
            ||.::::.|..:.........:|....::......:..|||.|...|.|..|.. :|..||    
  Fly   120 DIALVKVTPPFRLERSDISTILIGGSDRIGEKVPVRLTGWGSTSPSTSSATLPD-QLQALNYRTI 183

  Fly   180 ASECYNMLWVNVTESQICAGHPDGD-TCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLC--NS 241
            ::|..|.....||.::|||....|. .|.||||||||.|    |...:: :||:|:|||.|  ..
  Fly   184 SNEDCNQKGFRVTRNEICALAVQGQGACVGDSGGPLIRP----GKQPHL-VGIVSYGSSTCAQGR 243

  Fly   242 PGVYTRLSSFIDWILMVVD 260
            |.||||:|||:.:|..|::
  Fly   244 PDVYTRVSSFLPYISQVIN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 70/234 (30%)
Tryp_SPc 34..255 CDD:238113 70/233 (30%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 70/233 (30%)
Tryp_SPc 31..260 CDD:238113 71/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.