DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG17404

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:215 Identity:69/215 - (32%)
Similarity:108/215 - (50%) Gaps:33/215 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CGGTLIHKQFVLSAAHCIK-----RDQILA-VRLGEHSSSRYFAVTKAFRNKYFTTGSYSNDIGI 122
            |||::|....:|:||||.:     |..::| :|......||...::.:...||  ....::|:.:
  Fly    65 CGGSIIAPNRILTAAHCCQGLNASRMSVVAGIRGLNEKGSRSQVLSYSIHPKY--QELVTSDLAV 127

  Fly   123 LRIQPIVKF-NAVIRPICIITDPTK-----VPNVKTFKAAGWGK--------TENETFSKVLKTV 173
            |.|:|.:|. |:.|..|...:....     ||...|    |||.        .:|..:..||:.:
  Fly   128 LSIKPPLKLNNSTISAIEYRSQGKDFVGGGVPVTLT----GWGLRLPVPFPFLDNVNYPNVLQRM 188

  Fly   174 ELNELNASECYNMLWVNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSL 238
            ..:.::.|||.|....:||:::|||..|....|:|||||||:    |:......|:||:|:|..:
  Fly   189 SYHTISNSECRNAGMESVTDTEICARGPFRGACSGDSGGPLV----MESKNGLQQVGIVSYGLVV 249

  Fly   239 CN---SPGVYTRLSSFIDWI 255
            |.   ||.||||:|:|.|||
  Fly   250 CGLYISPDVYTRVSTFSDWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 67/213 (31%)
Tryp_SPc 34..255 CDD:238113 67/213 (31%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 67/213 (31%)
Tryp_SPc 35..269 CDD:238113 67/213 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.