DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG13318

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:261 Identity:70/261 - (26%)
Similarity:111/261 - (42%) Gaps:42/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGY----PDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRDQ 85
            ||.    |..|.....|| |..|..||.|.:....|..:.    ||.||..|.||:|||.:....
  Fly   151 CGRRFPPPPGSTTAAPGQ-ASFGAYPWQAALLTTADVYLG----GGALITAQHVLTAAHKVYNLG 210

  Fly    86 I--LAVRLGEHSS--------SRYFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKF--NAVIRPI 138
            :  ..|||||..:        ::...::..:.|..|...:..||:.||::...|..  .:.:..:
  Fly   211 LTYFKVRLGEWDAASTSEPIPAQDVYISNVYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGTV 275

  Fly   139 CIITDPTKVPNVKTFKAAGWGKTE---NETFSKVLKTVELNELNASECYNML--------WVNVT 192
            |:.|  |.....:.: .|||||.:   ...:..:.:.|::..:..:.|...|        :|...
  Fly   276 CLPT--TSFVGQRCW-VAGWGKNDFGATGAYQAIERQVDVPLIPNANCQAALQATRLGSSFVLSP 337

  Fly   193 ESQICAGHPDG-DTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNS--PGVYTRLSSFIDW 254
            .|.||||...| |.|.||.|.||   |.....:.|| :|::::|.....:  ||||..:.:::.|
  Fly   338 TSFICAGGEAGKDACTGDGGSPL---VCTSNGVWYV-VGLVAWGIGCAQAGVPGVYVNVGTYLPW 398

  Fly   255 I 255
            |
  Fly   399 I 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 64/247 (26%)
Tryp_SPc 34..255 CDD:238113 64/246 (26%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 64/242 (26%)
Tryp_SPc 169..399 CDD:214473 62/240 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435530
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.