DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and Prss45

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001008864.1 Gene:Prss45 / 408244 RGDID:1303021 Length:330 Species:Rattus norvegicus


Alignment Length:286 Identity:82/286 - (28%)
Similarity:124/286 - (43%) Gaps:49/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FIFTIFKIILLWP-----GAMSQFLEPNCGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAE 61
            :|.|.|..:||.|     |......||.||.|..|..:     .|....||...:...|     |
  Rat    18 WIPTCFAALLLLPPRPNLGYNEDHAEPVCGAPWWSDSL-----EERHHWPWEVSLQIEN-----E 72

  Fly    62 LVCGGTLIHKQFVLSAAHCIKRDQILAVRLGEHS---SSRYFAV-----TKAFRNKYFTTGSYSN 118
            .||||.||.:.:|:||||||:.::...|.||..:   |...:|:     ......||:......:
  Rat    73 HVCGGALIDQSWVVSAAHCIQGNKEYLVMLGSSTLQPSGSPWALKIPVGDIIMHPKYWGQNFIRS 137

  Fly   119 DIGILRIQPIVKFNAVIRPICIITDPTKVPNVKTFK---AAGWGKTENETFSKVLKTVELNELNA 180
            ||.:|.::..|.||..|:|||:   |....|:|...   ..|||:.:....:|:.:::||.|...
  Rat   138 DIALLCLETPVTFNKYIQPICL---PEHNFNLKVGMKCWVTGWGQAKQHPSAKLTRSLELWEAEV 199

  Fly   181 S-----EC---------YNMLWVNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGI 231
            |     .|         |..:...:.::.||..:...:.|.||.||||...|:.    |::..||
  Rat   200 SIVDNKNCDRVFHKKTFYPQVIPLIRKNMICTTNHRENPCYGDPGGPLACEVHG----RWILAGI 260

  Fly   232 ISFGSSLCNSP--GVYTRLSSFIDWI 255
            .|:..:...:|  .||||:..:..||
  Rat   261 FSWEKACTKAPNLSVYTRIDKYTGWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 67/248 (27%)
Tryp_SPc 34..255 CDD:238113 67/247 (27%)
Prss45NP_001008864.1 Tryp_SPc 57..289 CDD:238113 69/242 (29%)
Tryp_SPc 57..286 CDD:214473 67/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.