DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG7542

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:255 Identity:84/255 - (32%)
Similarity:128/255 - (50%) Gaps:42/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DISPKIMHGQNAENGTNPWMAYIFKYNDKEVA----ELVCGGTLIHKQFVLSAAHCIKRDQILAV 89
            |:.|.|.:|:.||.|..|:.|.:      .|:    ...||||||...::::||||:...:.:.|
  Fly    22 DVEPYITNGEPAEVGQFPYQAGL------NVSFGNWSTWCGGTLISHYWIITAAHCMDGAESVTV 80

  Fly    90 RLG--------EHSSSRYFAVTKA--FRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIITDP 144
            .||        |....| ..|.|:  ..:..:...:..|||.::|:...|.|...||...:   |
  Fly    81 YLGAINIGDESEEGQER-IMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASL---P 141

  Fly   145 TKV----PNVKTFK--AAGWGKTE--NETFSKVLKTVELNELNASECYNMLWVN-VTESQICAGH 200
            .::    |..::.:  |:|||:..  :::.|.||:.||:..:..|.| .|.|.. |:|..||...
  Fly   142 RRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLC-RMYWSGAVSEKMICMST 205

  Fly   201 PDG-DTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSL-C--NSPGVYTRLSSFIDWIL 256
            ..| .||.|||||||   ||..|:..|: :|..|||:|: |  ..|.|:||:||::||||
  Fly   206 TSGKSTCHGDSGGPL---VYKQGNSSYL-IGSTSFGTSMGCQVGFPAVFTRISSYLDWIL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 79/248 (32%)
Tryp_SPc 34..255 CDD:238113 79/247 (32%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 82/250 (33%)
Tryp_SPc 27..260 CDD:214473 79/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436328
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.