DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG4914

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:284 Identity:91/284 - (32%)
Similarity:140/284 - (49%) Gaps:57/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 WPGAMSQFLEP------------NCGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCG 65
            |.||.::...|            .||..:...:|:.|........||||.:..:|     ...||
  Fly    95 WFGAFNRNNSPAAQNQTSPTCSCRCGERNDESRIVGGTTTGVSEYPWMARLSYFN-----RFYCG 154

  Fly    66 GTLIHKQFVLSAAHCIKRDQ--ILAVRLGEHS--------SSRYFAVTKAFRNKYFTTGSYSNDI 120
            ||||:.::||:||||:|...  ::.|..|||.        .:|:  |.:||..| |:..::.|||
  Fly   155 GTLINDRYVLTAAHCVKGFMWFMIKVTFGEHDRCNDKERPETRF--VLRAFSQK-FSFSNFDNDI 216

  Fly   121 GILRIQPIVKFNAVIRPICIITDPTKVPNVKTFK---------AAGWGK-TENETFSKVLKTVEL 175
            .:||:...|...:.|||||:       |.|:..:         |.|||. .|:...|.:|:.||:
  Fly   217 ALLRLNDRVPITSFIRPICL-------PRVEQRQDLFVGTKAIATGWGTLKEDGKPSCLLQEVEV 274

  Fly   176 NELNASECY---NMLWVNVTESQICAGHP---DGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISF 234
            ..|:..||.   |.....:|::.:|:|:|   ..|:|.|||||||:.  ......|:.|:||:|:
  Fly   275 PVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGRDSCQGDSGGPLVR--LRPDDKRFEQIGIVSW 337

  Fly   235 GSSLC--NSPGVYTRLSSFIDWIL 256
            |:...  |.||||||::.::|||:
  Fly   338 GNGCARPNYPGVYTRVTKYLDWIV 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 83/249 (33%)
Tryp_SPc 34..255 CDD:238113 83/248 (33%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 83/249 (33%)
Tryp_SPc 128..363 CDD:238113 85/251 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.