DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG4477

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_648295.1 Gene:CG4477 / 39058 FlyBaseID:FBgn0035971 Length:315 Species:Drosophila melanogaster


Alignment Length:241 Identity:57/241 - (23%)
Similarity:105/241 - (43%) Gaps:51/241 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CGGTLIHKQFVLSAAHCI--KR-----DQILAVRLGEHSSSRYF-------AVTKAFRNKYFTTG 114
            |.|.::...||:::|||:  ||     .::|.:..|..:..:|.       .||..:....||..
  Fly    72 CSGVILAPMFVMTSAHCLINKRRVLISSRVLLIVAGTLNRLKYIPNRTFVTPVTHIWLPDSFTMR 136

  Fly   115 SYSNDIGILRIQ-PIVKFNAVIRPICIITDPTKVPNVKTFKAAGWGKT-ENETFSKVLKTVELNE 177
            : ..|.|:|::: |..:.|..|....:...| .:|.:|. |..|||:. :....:..:..:::..
  Fly   137 N-KQDFGLLKVKNPFPRNNEHISIARLPVHP-PLPGLKC-KVMGWGRMYKGGPLASYMLYIDVQV 198

  Fly   178 LNASECYNMLWVNVTESQICAGHPDGDT----CAGDSGGPLIHPVYMDGSLRYVQLGIISF--GS 236
            :::..|...|.|...| .:||...|..|    |.||.|.|::|    :|::    .||::.  |.
  Fly   199 IDSEACAKWLRVPSVE-HVCAVDSDDLTAQQPCGGDWGAPMLH----NGTV----YGIVTILAGC 254

  Fly   237 SLCNSPGVYTRLSSFIDWI----------LMVVDNYTVRSPPKIQY 272
            .:.:.|.:||.:.|..:||          :::|       ||..:|
  Fly   255 GVSHLPSLYTNVHSNANWIHEKIISSAGSILLV-------PPLFRY 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 51/212 (24%)
Tryp_SPc 34..255 CDD:238113 51/212 (24%)
CG4477NP_648295.1 Tryp_SPc 55..276 CDD:238113 53/215 (25%)
Tryp_SPc 55..273 CDD:214473 51/212 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.