DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and Jon66Ci

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:290 Identity:78/290 - (26%)
Similarity:117/290 - (40%) Gaps:74/290 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIF-TIFKIILLWPGAMSQFLEPNCGYPDISP------KIMHGQNAENGTNP----------WM 48
            |.:| ||..:.:....|....:.|.    |:|.      :|.:|..||.|..|          |.
  Fly     1 MKVFLTILALAVASASAYESVVHPK----DLSKVAKIEGRITNGYPAEEGKAPYTVGLGFSGGWW 61

  Fly    49 AYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRDQILAVRLGEHSSSRYFAVTKAFR-NKYFT 112
                           |||::|..::||:|.|||..|.:..          ||..|  :| |..||
  Fly    62 ---------------CGGSIISNEWVLTAEHCIGGDAVTV----------YFGAT--WRTNAQFT 99

  Fly   113 ----TGSY----SNDIGILRIQPIVKFNAVIRPICIITDPTKVPNVKTFK-----AAGWGKT-EN 163
                :|::    |.||.::|| |.|.|..::..:.:   |:.......:.     |.|||.| :.
  Fly   100 HWVGSGNFITHGSADIALIRI-PHVDFWHMVNKVEL---PSYNDRYNDYNEWWAVACGWGGTYDG 160

  Fly   164 ETFSKVLKTVELNELNASECYNMLWV-NVTESQICAGHPDG-DTCAGDSGGPLI-HPVYMDGSLR 225
            ......|:.|:|..::.|||.:.... .|.::.||....|| .||.|||||||: |    |||..
  Fly   161 SPLPDYLQCVDLQIIHNSECASYYGTGTVGDNIICVRVVDGKGTCGGDSGGPLVTH----DGSKL 221

  Fly   226 YVQLGIISFGSSLCNSPGVYTRLSSFIDWI 255
            ......:|........|..:.|::..:|||
  Fly   222 VGVTNWVSGAGCQAGHPAGFQRVTYHLDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 68/249 (27%)
Tryp_SPc 34..255 CDD:238113 68/248 (27%)
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 68/249 (27%)
Tryp_SPc 37..254 CDD:238113 70/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435767
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.