DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG33465

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:260 Identity:94/260 - (36%)
Similarity:134/260 - (51%) Gaps:17/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MSQFLEPNCGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCI 81
            ::|.|:..|..|..|..|.....|.. |.||||.|:|.|     :.:|.|||:||.|||:||.||
  Fly    18 LAQLLDKKCHDPKTSENINFNHGATE-TAPWMASIYKNN-----QFICDGTLVHKLFVLTAASCI 76

  Fly    82 KRDQILAVRLGEHS----SSRYF-----AVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRP 137
            .:|..|.|..|.::    :|::|     .|..|.::..|...:..||||:||:...|...|.|||
  Fly    77 SKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRP 141

  Fly   138 ICIITD-PTKVPNVKTFKAAGWGKTENETFSKVLKTVELNELNASECY-NMLWVNVTESQICAGH 200
            ||||.| ..|....:.|:..||.:...|..|:|.:||.|::....||: |...:.:.|.|.|||:
  Fly   142 ICIILDHVVKSAPFERFEGFGWQQQGTEASSQVRQTVYLSQKKPFECHRNGQLLPINEGQFCAGN 206

  Fly   201 PDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNSPGVYTRLSSFIDWILMVVDNYTVR 265
            .|...|..:||.||............||:|::|:||.||:...|||.:.:|.|||...|.|:..:
  Fly   207 RDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSPTSVYTDVVAFKDWIYNTVRNFETK 271

  Fly   266  265
              Fly   272  271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 85/232 (37%)
Tryp_SPc 34..255 CDD:238113 85/231 (37%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 84/222 (38%)
Tryp_SPc 46..261 CDD:214473 82/219 (37%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463404
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.