DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and sphinx2

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:252 Identity:54/252 - (21%)
Similarity:105/252 - (41%) Gaps:44/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCG-GTLIHKQFVLSAAHCIKRDQILA 88
            |....:||:|..|..|:..|..::..|. |....::.|..| ||:|..|::|:.     ::.::.
  Fly    17 CEKNKLSPRITGGYRAKPYTIIYLVGIV-YAKSPLSSLKFGAGTIISNQWILTV-----KEVLIF 75

  Fly    89 VRLGEHSSSRY----FAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIITDPTKVPN 149
            ..:..|..|:.    :.:.:.:|..::.....:..|.:::. |..||:   |.:..:..|.....
  Fly    76 KYIEAHFGSKRAFWGYDILRIYRENFYFHYDKTRIIALVKC-PYQKFD---RRMSRVRVPAYGAR 136

  Fly   150 VKTF-----KAAGWGKTENET-FSKVLKTVELNELNASEC--YN--MLWVNVTESQICAGHPDGD 204
            .:.:     ...|||..:.:. ....::.||:..:|.:||  |:  :.|..:..|    |.....
  Fly   137 FERYVGNMTMVCGWGTDKRKVRLPTWMRCVEVEVMNNTECAKYHTPLKWYEMCTS----GEGFKG 197

  Fly   205 TCAGDSGGPLI----HPVYMDGSLRYVQLGIISFGSSLCN--SPGVYTRLSSFIDWI 255
            .|.||.||.::    :|.:         :|||....:.|:  .|.|:.|:|..|.||
  Fly   198 VCEGDMGGAVVTMGPNPTF---------IGIIWLMPTNCSIGYPSVHIRVSDHIKWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 49/242 (20%)
Tryp_SPc 34..255 CDD:238113 49/241 (20%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 49/242 (20%)
Tryp_SPc 26..248 CDD:304450 51/243 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436361
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.