DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG10469

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:252 Identity:73/252 - (28%)
Similarity:122/252 - (48%) Gaps:40/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SPKIMHGQNAENGTNPWMAYIFKYNDKEVAE-LVCGGTLIHKQFVLSAAHCIKRDQI----LAVR 90
            |.:||:|..|:....|:...:..|.:....| .:||||::..:::::||||::..:.    :.:.
  Fly    21 SLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIH 85

  Fly    91 LGEHSS--SRYFAVTKAFR--NKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIITDPTKVPNV- 150
            :|:..|  .:...|.:::.  :|.|...:.:|||.::::...:.||..|:       |.|:|:. 
  Fly    86 VGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQ-------PAKLPSAK 143

  Fly   151 KTF---KA--AGWGKTENETFSKVLKTVELNELNASECYNMLWVN---------VTESQICAGHP 201
            ||:   ||  :|||.|..:..|:||:.:....::..||... |..         |....||....
  Fly   144 KTYTGRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQ-WNKQLGGKSKKVVHNGFICIDSK 207

  Fly   202 DGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFG-SSLC--NSPGVYTRLSSFIDWI 255
            .|..|.||||||:   |..|||...|  ||:|.| ...|  ..|.|.||:||::.||
  Fly   208 KGLPCRGDSGGPM---VLDDGSRTLV--GIVSHGFDGECKLKLPDVSTRVSSYLKWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 70/248 (28%)
Tryp_SPc 34..255 CDD:238113 70/247 (28%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 70/248 (28%)
Tryp_SPc 24..260 CDD:238113 72/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436460
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.