DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG6592

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:214 Identity:68/214 - (31%)
Similarity:108/214 - (50%) Gaps:29/214 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CGGTLIHKQFVLSAAHCIKRDQILAVRLG--------EHSSSRYFAVTKAFRNKYFTTGS---YS 117
            |||:||..:.|::||||:...:...|.||        |....|....::.|  :.:.|.:   ..
  Fly   151 CGGSLISDKHVITAAHCVDMAKRALVFLGANEIKNAKEKGQVRLMVPSENF--QIYPTWNPKRLK 213

  Fly   118 NDIGILRIQPIVKFNAVIRPICIITDPTKVPNVKTFK-----AAGWGK--TENETFSKVLKTVEL 175
            :||.|:|:...|.||..|.||.:   |.:....::||     |:|||:  |.....|.||:.|:|
  Fly   214 DDIAIVRLPHAVSFNERIHPIQL---PKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQL 275

  Fly   176 NELNASECYNMLWVNVTESQIC-AGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSL- 238
            ..::...|.:...::...:.|| :|.....||.|||||||:  :....|.:.|.:||.||||.. 
  Fly   276 QIIDGRTCKSNFPLSYRGTNICTSGRNARSTCNGDSGGPLV--LQRRHSKKRVLVGITSFGSIYG 338

  Fly   239 CNS--PGVYTRLSSFIDWI 255
            |:.  |..:|:::|::|||
  Fly   339 CDRGYPAAFTKVASYLDWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 66/212 (31%)
Tryp_SPc 34..255 CDD:238113 66/212 (31%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 66/212 (31%)
Tryp_SPc 123..359 CDD:238113 68/214 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436427
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.