DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:262 Identity:74/262 - (28%)
Similarity:111/262 - (42%) Gaps:80/262 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GYPDISPKIMH--GQN-AENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRDQIL 87
            |||....|:.:  |.. ::||...|                |||::|...:|::|.||..     
  Fly    41 GYPAYEGKVPYIVGLGFSKNGGGTW----------------CGGSIIGNTWVMTAKHCTD----- 84

  Fly    88 AVRLGEHSSSRYFAVTKAF---------RNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIITD 143
                |..|.:.|:......         |:.:...|  |.||.::| .|.|.|.:::..:.:...
  Fly    85 ----GMESVTIYYGALWRLQAQYTHWVGRSDFIEHG--SGDISLIR-TPHVDFWSLVNKVELPRY 142

  Fly   144 PTKVPNVKTFKA--AGWGKTENETFSKVLKTVELNELNASECYNMLWVNVTESQICA---GHPDG 203
            ..:..|.:.:.|  :|||||.:|.             ..||..|.:.|.:.|:.:|.   |...|
  Fly   143 DDRYNNYQGWWALVSGWGKTSDEG-------------GVSEYLNCVDVQIGENSVCENYYGSFSG 194

  Fly   204 D-----------TCAGDSGGPL-IHPVYMDGSLRYVQLGIISFGSS---LCNSPGVYTRLSSFID 253
            |           ||:||||||| ||    ||:.   |:||:|||||   |.|.|....|::|::|
  Fly   195 DLICIPTPENKGTCSGDSGGPLVIH----DGNR---QVGIVSFGSSAGCLSNGPKGMVRVTSYLD 252

  Fly   254 WI 255
            ||
  Fly   253 WI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 69/253 (27%)
Tryp_SPc 34..255 CDD:238113 68/252 (27%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 72/260 (28%)
Tryp_SPc 41..257 CDD:238113 74/262 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435602
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.