DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:283 Identity:86/283 - (30%)
Similarity:132/283 - (46%) Gaps:54/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FKIILLWPGAMSQFLEPNCGY--------PDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELV 63
            |.|||....|.|.|.||...:        .||..:|..|.||..|..|:...: ......::...
  Fly     3 FLIILALAVAASAFPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGL-SLKLSALSSAW 66

  Fly    64 CGGTLIHKQFVLSAAHCIKRDQILAVRLG---------EHSSSRYFAVTKAFRNKYFTTGSYSND 119
            |||:||...:||:||||....|.:.|.||         .|:.|....:..:..|    :.:..||
  Fly    67 CGGSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTSAEITHTVSSSDIIIHSGWN----SANLRND 127

  Fly   120 IGILRIQPIVKFNAVIRPICIITDPTKVPNV----KTF-----KAAGWGKTENETFSKV---LKT 172
            |.:::| |....::.|..:       |:|::    .||     .|:|||:| ::|.|.|   |:.
  Fly   128 ISLIKI-PATSSSSRISAV-------KLPSISNSYSTFVGDVAVASGWGRT-SDTSSGVATNLQY 183

  Fly   173 VELNELNASECYNMLWVN-VTESQICAGHPDG-DTCAGDSGGPLIHPVYMDGSLRYVQLGIISFG 235
            |:|..:..::|......: ||:|.:|....|. .||.|||||||:    :..|..  |:|:.|||
  Fly   184 VDLTVITNTKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLV----LKSSSE--QIGLTSFG 242

  Fly   236 SSL-CNS--PGVYTRLSSFIDWI 255
            :|. |..  |..:||::|::|||
  Fly   243 ASAGCEKGYPAAFTRVTSYLDWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 73/247 (30%)
Tryp_SPc 34..255 CDD:238113 73/246 (30%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 73/247 (30%)
Tryp_SPc 38..268 CDD:238113 75/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436262
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.