DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and yip7

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:276 Identity:78/276 - (28%)
Similarity:130/276 - (47%) Gaps:40/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IFKIILLWPGAMSQFLEPN---------CGYPDISPKIMHGQNAENGTNPWMAYI-FKYNDKEVA 60
            :|.:::|...:.|..|.||         ...|.|:.:|.:|::|..|..|:...: |   .....
  Fly     3 VFVVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSF---SSSAG 64

  Fly    61 ELVCGGTLIHKQFVLSAAHCIKRDQILAVRLGE--HSSSRYFAVTKAFRNKYFTTGSY-----SN 118
            ...|||::|..::||:||||......:.:..|.  .:|..:..|..:  :|:....||     .|
  Fly    65 SWWCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSS--SKFRQHESYLALTIRN 127

  Fly   119 DIGILRIQPIVKFNAVIRPICI--ITDPTKVPNVKTFKAAGWGKTENE--TFSKVLKTVELNELN 179
            ||.:::... |.|:|.:..|.:  :::.......||..|:|||.|.::  ..|:.|:.|:|..::
  Fly   128 DISLIQTSS-VSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIIS 191

  Fly   180 ASECYNMLW-VNVTESQICAGHPD-GDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSS-LCNS 241
            .|:|..... :.||...:|....: ..||.|||||||.    :||    |.:|..||||: .|.|
  Fly   192 NSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLA----LDG----VLIGATSFGSADGCES 248

  Fly   242 --PGVYTRLSSFIDWI 255
              |..:||::.:.|||
  Fly   249 GAPAAFTRITYYRDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 68/238 (29%)
Tryp_SPc 34..255 CDD:238113 68/237 (29%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 68/238 (29%)
Tryp_SPc 40..267 CDD:238113 70/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436163
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.