DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG10477

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:255 Identity:71/255 - (27%)
Similarity:110/255 - (43%) Gaps:51/255 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PDISPKIMHGQNAENGTNPWMAYI-FKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRDQILAVRL 91
            |.|..:|.:|..|.....|:...: ||   .......|||::|...:||:||||.|         
  Fly    34 PSIDGRITNGNKAAANQFPYQVGLSFK---SSAGSWWCGGSIIANTWVLTAAHCTK--------- 86

  Fly    92 GEHSSSRYFAVT---------KAFRNKYFTTGSYS-----NDIGILRIQPIVKFNAVIRPICIIT 142
            |..|.:.|:..|         |...:|:.....|:     |||.::: .|.|.|...|..|.:  
  Fly    87 GASSVTIYYGSTVRTSAKLKKKVSSSKFVQHAGYNAATLRNDISLIK-TPSVTFTVSINKIAL-- 148

  Fly   143 DPTKVPNVKTFK-----AAGWGKTENETFSKV--LKTVELNELNASECYNMLWVN-VTESQICAG 199
             |....:..|:.     |:|||:|.:.:.:..  |:..:...:..:.|......: ||...||..
  Fly   149 -PAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVICVE 212

  Fly   200 HPD-GDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSL-C--NSPGVYTRLSSFIDWI 255
            ..: ..||.|||||||        :|....:|:.||.||. |  |:|..:||::|::|||
  Fly   213 SINKKSTCQGDSGGPL--------ALNNRLIGVTSFVSSKGCEKNAPAGFTRVTSYLDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 67/248 (27%)
Tryp_SPc 34..255 CDD:238113 67/247 (27%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 67/248 (27%)
Tryp_SPc 40..267 CDD:238113 69/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436196
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.