DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG30414

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:295 Identity:94/295 - (31%)
Similarity:142/295 - (48%) Gaps:52/295 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILLWPGAMSQFLEPNCG--YPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQ 72
            |.|..||....|:.:||  .|:..|.|..|.:|...:||||.       |.:.|.:|||:||..:
  Fly    15 IQLGEGAPGHLLDSSCGTTKPEFIPMITGGADAGLFSNPWMV-------KVLGEKLCGGSLITSR 72

  Fly    73 FVLSAAHCIKRDQILAVRLGEHSS-------SRYFAVTKAFRNKYFTTGSY-------------- 116
            |||:|||||.... :.|||||:.:       ||  .|.|:::.:....|.|              
  Fly    73 FVLTAAHCIVSTH-MRVRLGEYKTRFPGKDCSR--CVPKSYKLRRIRLGEYDTRFPGKDCCVPKS 134

  Fly   117 ------------------SNDIGILRIQPIVKFNAVIRPICIITDPTKVPNVKTFKAAGWGKTEN 163
                              .||||:||::..|:::..:||||::.: ..:.....|...|||.|.:
  Fly   135 YELAVDRKILHADYNLNLDNDIGLLRMKSFVQYSDYVRPICLLVE-GHMAESPIFNITGWGVTND 198

  Fly   164 ETFSKVLKTVELNELNASECYNMLWVNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQ 228
            .|.|:.|:...:...:...|.:.....|.||||||...:.|.|.|||||||...|...||....|
  Fly   199 GTPSRRLQRATVYNTDLHFCRSKFTKQVDESQICAAGTNSDACHGDSGGPLSAQVPFAGSWLTFQ 263

  Fly   229 LGIISFGSSLCNSPGVYTRLSSFIDWILMVVDNYT 263
            .|::|:||:.|:|..|||.::...|||:..:::::
  Fly   264 YGLVSYGSAACHSFSVYTNVTHHRDWIVNAIEDFS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 83/260 (32%)
Tryp_SPc 34..255 CDD:238113 83/259 (32%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 83/259 (32%)
Tryp_SPc 41..290 CDD:238113 83/259 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.