DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and tpr

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:251 Identity:79/251 - (31%)
Similarity:130/251 - (51%) Gaps:34/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIK--RDQIL 87
            ||..:|..:|:.||..|....||:|.:. |..:    ..|..:|::.||:|:|:||:.  |.:.:
  Fly   118 CGIANIQKRIVGGQETEVHQYPWVAMLL-YGGR----FYCAASLLNDQFLLTASHCVYGFRKERI 177

  Fly    88 AVRLGEHSSSRYF------AVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIITDPTK 146
            :|||.||......      .|.:...:..:...:|.|||.|:::...|:||.|:.|:|:   || 
  Fly   178 SVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCM---PT- 238

  Fly   147 VPNVKTFK-----AAGWG--KTENETFSKVLKTVELNELNASECYNMLWVN-VTESQICAGHPDG 203
             |. ::||     ..|||  |....| |..|:.|::..|:..||....:.| :|::.:|.|:.:|
  Fly   239 -PG-RSFKGENGIVTGWGALKVGGPT-SDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYDEG 300

  Fly   204 --DTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNS--PGVYTRLSSFIDWI 255
              |:|.||||||| | :...|:..:...|::|:|.....:  ||||.|::.:..||
  Fly   301 GKDSCQGDSGGPL-H-IVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 74/241 (31%)
Tryp_SPc 34..255 CDD:238113 74/240 (31%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 74/241 (31%)
Tryp_SPc 127..356 CDD:238113 76/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.