DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG30283

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:275 Identity:97/275 - (35%)
Similarity:140/275 - (50%) Gaps:34/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IFKIILLWPGA--------MSQFLEPNCGYPDISP-KIMHGQNAENGTNPWMAYIFKYNDKEVAE 61
            ||.:::|...:        ...|||..||...||. ||:.|.||...:.||||.:.....     
  Fly     6 IFVVVVLLAASSVVVLGSESGSFLEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEGG----- 65

  Fly    62 LVCGGTLIHKQFVLSAAHCIKRDQILAVRLG---EHSSSRYFAVTKAF--RNKYFTTGSYSNDIG 121
            ..||||||..:|||::||||...: |.||||   ..:.::.|||...|  .:.||.    .:|:.
  Fly    66 FHCGGTLITNRFVLTSAHCIANGE-LKVRLGVLEREAEAQKFAVDAMFVHTDYYFD----QHDLA 125

  Fly   122 ILRIQPIVKFNAVIRPICIITDPTKVPNVK----TFKAAGWGKTENETFSKVLKTVELNELNASE 182
            :||:...|.::..|.|||::.||. |.|:.    .|:..||||||:.:.|::|:...|..|:.||
  Fly   126 LLRLAKRVHYSDNISPICLLLDPL-VKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLHRSE 189

  Fly   183 C---YNMLWVNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNSPGV 244
            |   |....:|  .:.|||...:.:||.|||||||...|..|......|.|:.|||.:.|:...|
  Fly   190 CAKQYPHQQIN--RNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKATV 252

  Fly   245 YTRLSSFIDWILMVV 259
            :|.:.:.:|||:..|
  Fly   253 FTNVMTHLDWIVNTV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 84/233 (36%)
Tryp_SPc 34..255 CDD:238113 83/232 (36%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 84/233 (36%)
Tryp_SPc 43..266 CDD:238113 85/235 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.860

Return to query results.
Submit another query.