DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG10764

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:244 Identity:104/244 - (42%)
Similarity:137/244 - (56%) Gaps:14/244 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QFLEPNCGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIKR 83
            :|||..||. ...|||..|.:|....:.|||.||..:|.:     ||||:||.:||||||||:.|
  Fly    24 KFLETPCGI-STRPKISGGDDAAEPNSIWMAAIFNSSDFQ-----CGGTIIHMRFVLSAAHCLVR 82

  Fly    84 DQILAVRLGEHSSSRYFA---VTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIITDPT 145
            ...|.||||..:.:...|   |...|.:..|....|.||||:|::...:.:...::||||..||.
  Fly    83 GYDLYVRLGARNINEPAAVHTVINVFVHHDFIASEYRNDIGLLQLSESIVYTVRVQPICIFLDPA 147

  Fly   146 ---KVPNVKTFKAAGWGKTENETFSKVLKTVELNELNASECYNMLWVNVTESQICAGHPDGDTCA 207
               .|..:|||:|.||| ..|...|.:|:|:.|..|..:||...|..|:...|||||..:||||.
  Fly   148 LKGSVEKLKTFRALGWG-NRNGKLSIMLQTIYLLHLKRNECKRKLNFNLNSRQICAGTKNGDTCR 211

  Fly   208 GDSGGPLIHPVYMDGSLRY-VQLGIISFGSSLCNSPGVYTRLSSFIDWI 255
            |||||||...:....:..| |||||:|||...|...||||.::|::|||
  Fly   212 GDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGVGVYTDVTSYVDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 96/228 (42%)
Tryp_SPc 34..255 CDD:238113 95/227 (42%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 96/228 (42%)
Tryp_SPc 38..263 CDD:238113 97/229 (42%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463400
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4848
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.790

Return to query results.
Submit another query.