DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG12133

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:290 Identity:90/290 - (31%)
Similarity:136/290 - (46%) Gaps:49/290 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGYPDISPKIMHGQNAENGTNPWMAYI--FKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRDQ-- 85
            ||....|..|:.|..|::...||...:  ..|..|:....:|.|:||..::||:||||:..:.  
  Fly    53 CGQSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDFY 117

  Fly    86 ILAVRLGEH------------SSSRYFAVT--------KAFRNKYFT-TGSYSNDIGILRIQPIV 129
            :..||||||            :.::.:|..        :....:|:| .|.:.|||.:||::..|
  Fly   118 VARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRV 182

  Fly   130 KFNAVIRPICIITDPTKVPNVK---------TFKAAGWGKTENETFSKVLKTVELNELNASEC-- 183
            |:...||||||      .|.::         .|:.||||.:..:..|.||:...::.::..||  
  Fly   183 KYTLQIRPICI------WPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSPDECLN 241

  Fly   184 -YNMLWVNVTESQICAGHPDG-DTCAGDSGGPLIHPVYMDGSLRYVQLGIISFG---SSLCNSPG 243
             |..|.|: .:.||||...|| ||..||||.||:..|.......|...||.|:|   ||....|.
  Fly   242 RYPTLLVD-KDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYGPA 305

  Fly   244 VYTRLSSFIDWILMVVDNYTVRSPPKIQYR 273
            |||:.||:.:||...: |.......|::|:
  Fly   306 VYTKTSSYYEWIKKKI-NDIAEDERKMKYK 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 82/262 (31%)
Tryp_SPc 34..255 CDD:238113 82/261 (31%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 84/264 (32%)
Tryp_SPc 62..317 CDD:214473 82/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463550
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.