DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG8738

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster


Alignment Length:276 Identity:82/276 - (29%)
Similarity:128/276 - (46%) Gaps:48/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MSQFLEPNCGYPDISPKIMHGQ--NAENGTN-----PWMAYIFKYNDKEVAELVCGGTLIHKQFV 74
            :..||...|||.  :||.::.|  ...||.:     |||..:.   |.| ...||||||||.|.|
  Fly   180 VKDFLLKGCGYS--NPKGLYYQLDGYNNGESVFAEFPWMVALM---DME-GNFVCGGTLIHPQLV 238

  Fly    75 LSAAHCI--KRDQILAVRLGE---HSSSRYF-----AVTKAFRNKYFTTGSYSNDIGILRIQPIV 129
            |::||.:  :.:..|.||.|:   :|.:...     |:::..|::.|...:..|||.::.::...
  Fly   239 LTSAHNVFNRSEDSLLVRAGDWDLNSQTELHPYQMRAISELHRHENFNNLTLYNDIALVVLERPF 303

  Fly   130 KFNAVIRPICIITDPTKVPNVK------TFKAAGWG--KTENETFSKVLKTVELNELNASECYNM 186
            :....|:|||:  .|.:.|.::      :..|.|||  .:.:.|...:||.:||..::...|..:
  Fly   304 QVAPHIQPICL--PPPETPQMEAELRSASCLATGWGLRYSTSRTMENLLKRIELPAVDHESCQRL 366

  Fly   187 L-------WVNVTESQICAGHPDG-DTCAGDSGGPLI--HPVYMDGSLRYVQLGIISFGSSLCNS 241
            |       ..|:..|..|||...| |||.||.|.||.  .|...|   ||..:|::|:|......
  Fly   367 LRHTVLGRRYNLHPSFTCAGGVKGKDTCMGDGGSPLFCTLPGQKD---RYQLVGLVSWGIECAEK 428

  Fly   242 --PGVYTRLSSFIDWI 255
              |..||.::...:||
  Fly   429 DVPAAYTNVAYLRNWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 74/258 (29%)
Tryp_SPc 34..255 CDD:238113 73/257 (28%)
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 72/247 (29%)
Tryp_SPc 207..444 CDD:214473 70/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.